- Recombinant Saccharomyces cerevisiae Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial (SDH3)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1258699
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 22,068 Da
- E Coli or Yeast
- 51-198
- CYB3, YKL4
- Succinate dehydrogenase [ubiquinone] cytochrome b subunit, mitochondrial (SDH3)
Sequence
NVASEMNTKAAIAEEQILNKQRAKRPISPHLTIYQPQLTWYLSSLHRISLVLMGLGFYLFTILFGVSGLLGLGLTTEKVSNWYHQKFSKITEWSIKGSFAYLFAIHYGGAIRHLIWDTAKELTLKGVYRTGYALIGFTAVLGTYLLTL